DGCR8 anticorps (N-Term)

N° du produit ABIN633303

Cet anticorps anti-DGCR8 est un anticorps Lapin Polyclonal détectant DGCR8 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour DGCR8 anticorps (N-Term) (ABIN633303)

Antigène: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGCR8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DGCR8 anticorps

Épitope: N-Term

Specificité: DGCR8 antibody was raised against the N terminal of DGCR8

Purification: Affinity purified

Immunogène: DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGCR8 Blocking Peptide, (ABIN937407), is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGCR8

Antigène: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Autre désignation: DGCR8

Sujet: DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways